PNC-27 is a synthetic 32-residue chimeric peptide that joins residues 12-26 of the human p53 transactivation domain to a 17-residue penetratin-derived membrane-residency sequence, and it is used in laboratory research as a chemical probe for HDM-2 (human double minute 2) expressed at the plasma membrane of transformed cell lines. In the published in-vitro literature it co-localizes with membrane-bound HDM-2, is associated with transmembrane pore formation, and produces rapid membranolytic cell death in a range of cancer cell lines while leaving matched untransformed lines in the same experiments largely unaffected. This article reviews the compound's design, the reported mechanism, the peer-reviewed record from 2001 through 2026, unresolved mechanistic disagreements, and laboratory handling. All information here is provided strictly for in-vitro and laboratory research use only.
What Is PNC-27?
PNC-27 belongs to a family of p53-derived chimeric peptides first described by Kanovsky and colleagues in PNAS in 2001. That work took three segments of the amino-terminal mdm-2 binding domain of human p53 — residues 12-26, 12-20, and 17-26 — and fused each at its carboxyl terminus to the penetratin sequence KKWKMRRNQFWVKVQRG, drawn from the Antennapedia homeodomain. The design rationale was conformational: the penetratin addition was intended both to carry the construct across the plasma membrane and to stabilise the α-helical geometry that the p53 segment adopts when bound to mdm-2/HDM-2. All three constructs were cytotoxic to human cancer cell lines in culture, while an unrelated control peptide carrying the same penetratin tail was not.
The two constructs that persisted in the literature are:
- PNC-27 — p53 residues 12-26 (PPLSQETFSDLWKLL) plus the penetratin/membrane-residency peptide (MRP), giving the full 32-residue sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG.
- PNC-28 — the shorter p53 17-26 segment fused to the same MRP.
Mechanism of Action
Membrane-localized HDM-2 as the target
HDM-2 is best known as the nuclear E3 ubiquitin ligase that negatively regulates p53. The premise underlying PNC-27 research is different: several groups have reported that a pool of HDM-2 is displayed on the outer plasma membrane of transformed cells and is present at low or undetectable levels on the membranes of corresponding untransformed cells. Because PNC-27 carries the p53 sequence that docks into the HDM-2 p53-binding pocket (residues 1-109), it engages this membrane pool rather than the nuclear pool.
Sarafraz-Yazdi and colleagues reported in PNAS (2010) that PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding HDM-2 in their membranes, establishing the membrane-target model that later work built on.
Pore formation and "poptosis"
The cell-death mode reported is necrotic rather than apoptotic. Bowne and colleagues (Annals of Surgical Oncology, 2008) attributed this to the penetratin segment specifically: PNC-28 containing the penetratin tail induced rapid necrosis in human pancreatic cancer cells, whereas removing that segment shifted the observed death toward apoptosis.
The structural picture was sharpened in Biomedicines (2022). Conformational energy calculations predicted 1:1 PNC-27:HDM-2 complexes with the leader sequence oriented away from the interface. Immuno-scanning electron microscopy of treated cancer cells, using an anti-PNC-27 antibody tagged with 6 nm gold and an anti-HDM-2 antibody tagged with 15 nm gold, found the two labels in approximately 1:1 ratios arranged in layered, ring-shaped structures at pores near the cell surface. No pores were observed in PNC-27-treated untransformed control fibroblasts. The authors proposed that the pores are lined by PNC-27–HDM-2 complexes.
This proposed death modality — peptide-induced transmembrane pore formation leading to extrusion of intracellular contents — was given the name poptosis in a 2024 Biomedicines review by Pincus and colleagues, which consolidates the PNC-27/PNC-28 literature under that framework.
Mitochondrial involvement
A 2024 study in Annals of Clinical and Laboratory Science (Krzesaj et al., 54:137-148) reported a second interaction: beyond binding plasma-membrane HDM-2, PNC-27 entered cancer cells and associated with mitochondrial membranes, causing mitochondrial disruption. This suggests the observed cytotoxicity may involve more than one membrane compartment.
Published Research Overview
The peer-reviewed record on PNC-27 spans roughly 25 years and is entirely pre-clinical — cell culture, ex vivo patient-derived material, and rodent xenografts. Selected primary studies:
- Kanovsky et al., PNAS, 2001 (98:12438-12443). Original design and first demonstration that p53-mdm-2-domain/penetratin chimeras are selectively cytotoxic to transformed cells.
- Michl et al., International Journal of Cancer, 2006 (119:1577-1585). PNC-28 induced necrosis rather than apoptosis across several human tumor lines, including lines with homozygous p53 deletion, and blocked growth of a ras-transformed rat pancreatic carcinoma line in a nude-mouse model during administration.
- Bowne et al., Annals of Surgical Oncology, 2008. Isolated the penetratin sequence as the determinant of the necrotic rather than apoptotic death mode in human pancreatic cancer cells.
- Sarafraz-Yazdi et al., PNAS, 2010 (107:1918-1923). Conformational and cellular evidence that PNC-27 kills by binding HDM-2 in cancer cell membranes.
- Ann Clin Lab Sci, 2014 (44:241). Reported that necrosis of a poorly differentiated non-solid-tissue human leukemia line depended on HDM-2 expression in the plasma membrane of those cells.
- Wang et al., Leukemia, 2020 (34:75-86). An independent group reported that membrane HDM2 is expressed on human and mouse AML blasts, including leukemia-stem-cell-enriched subpopulations, but not on normal hematopoietic stem cells, and that higher membrane HDM2 tracked with leukemia-initiating capacity, quiescence, and chemoresistance. Notably, this group proposed a different downstream mechanism (see below).
- Bowne et al., Anticancer Research, 2020 (40:4857-4867). Flow cytometry showed high membrane HDM-2 in U937, OCI-AML3, and HL-60 leukemia lines; PNC-27 treatment produced necrosis with lactate dehydrogenase (LDH) release within 4 hours, assessed alongside MTT viability, annexin V, and caspase-3 markers.
- Sarafraz-Yazdi et al., Biomedicines, 2022 (10:945). The immuno-EM pore-structure study described above.
- Krzesaj et al., Ann Clin Lab Sci, 2024 (54:137-148). Plasma-membrane HDM-2 binding plus mitochondrial membrane disruption.
- Miller et al., Medical Research Archives, 2025 (13:5). The most recent primary report at time of writing. Three cervical carcinoma lines (HTB-35/SiHa and SW756, both squamous; HeLa, endocervical) were killed with IC50 values of roughly 7-17 µM — among the lowest the authors report across their cell-line panel, compared with roughly 33 µM for several breast and pancreatic lines. Primary normal cervical epithelial cells (PCS-480-011) were unaffected at the maximum concentration tested (20 µM). Adding lithium acetoacetate at 10-20 mM lowered the PNC-27 IC50 roughly two- to three-fold in these lines.
Competing Mechanistic Interpretations
One of the more interesting features of this literature for a laboratory audience is that the two research groups reporting on membrane HDM-2 do not agree on what happens after binding.
- The SUNY Downstate / Thomas Jefferson group (Pincus, Michl, Bowne, Sarafraz-Yazdi and colleagues) describes direct physical pore formation by PNC-27–HDM-2 complexes — "poptosis" — with pore structures visualised by immuno-EM.
- Wang et al. (Leukemia, 2020) instead report that PNC-27 binding enhances the interaction between membrane HDM2 and E-cadherin, and that resulting E-cadherin ubiquitination and degradation lead to membrane damage and AML blast death by a process they term necrobiosis.
Limitations and Open Questions
Neutral reporting of this record requires noting several constraints:
- Authorship concentration. The large majority of PNC-27 primary papers originate from one collaborating network of investigators. The Wang et al. Leukemia (2020) study is the most prominent independent line of work supporting membrane HDM2 as a cancer-selective target, and it advances a different mechanism.
- Effective concentrations are in the micromolar range. Reported IC50 values of roughly 7-33 µM are high relative to targeted small molecules and are typical of membranolytic cationic peptides. Because the penetratin/MRP segment is itself amphipathic and highly basic, distinguishing HDM-2-dependent pore formation from generic concentration-dependent membrane lysis requires careful controls — scrambled-sequence and MRP-only comparators, and matched untransformed lines run in parallel.
- Membrane HDM-2 detection is assay-dependent. Surface expression is generally established by flow cytometry and immuno-EM with antibodies; the breadth of normal tissue types surveyed for surface HDM-2 remains limited.
- Journal tier varies. Several key reports appear in specialty or lower-impact venues; the strongest independent venues in the record are PNAS (2001, 2010) and Leukemia (2020).
- No human clinical data. As of August 2026, no completed human clinical trial of PNC-27 has been reported in the peer-reviewed literature. All efficacy claims in the record derive from cell culture, ex vivo material, and rodent xenograft models. Conservation of a target across species is not evidence of clinical effect.
Storage & Handling
Dynamite Research Peptides supplies PNC-27 as a lyophilized (freeze-dried) powder. Store the powder at -20°C or below, protected from light and moisture. Reconstitute immediately before use with an appropriate sterile solvent, keep reconstituted material refrigerated, and avoid repeated freeze-thaw cycles, which can compromise peptide integrity.
Two handling notes are specific to this construct. First, PNC-27 is strongly cationic and amphipathic, and cationic peptides of this class can adsorb to polypropylene and glass surfaces; low-binding tubes and consistent vehicle preparation help keep working concentrations reproducible across replicates. Second, because the reported mechanism is membranolytic, freshly prepared working solutions and matched vehicle controls are important — peptide aggregation on storage can alter apparent potency. Handle with appropriate personal protective equipment in a well-ventilated laboratory setting.
Conclusion
PNC-27 is a long-studied tool compound for interrogating a specific and unusual hypothesis: that HDM-2 mislocalised to the plasma membrane of transformed cells constitutes a selectively targetable surface feature. Its research value lies in that mechanistic question — membrane protein mislocalisation in transformation, peptide-induced membrane permeabilisation, and the distinction between necrotic and apoptotic death modes — rather than in any established application. The mechanistic disagreement between the pore-formation and E-cadherin-degradation models remains open and is itself a productive experimental target. Our PNC-27 is high-purity and third-party tested so that experimental results stay reliable and reproducible.
Frequently Asked Questions
What is PNC-27?
PNC-27 is a synthetic 32-residue chimeric peptide combining residues 12-26 of the human p53 transactivation domain — the segment that binds HDM-2 — with a 17-residue penetratin-derived membrane-residency sequence. It is used as a laboratory research probe for membrane-localized HDM-2 and for peptide-induced membrane permeabilisation.
What is the PNC-27 amino acid sequence?
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. The first 15 residues are the p53 12-26 segment; the remaining 17 are the penetratin/membrane-residency peptide.
How does PNC-27 differ from PNC-28?
Both carry the same penetratin/MRP tail. PNC-27 uses p53 residues 12-26; PNC-28 uses the shorter 17-26 segment. Both were described in the original 2001 PNAS design paper.
What is "poptosis"?
It is the term introduced in a 2024 Biomedicines review for peptide-induced transmembrane pore formation as a cell-death modality — distinct from apoptosis — in which pore formation leads to extrusion of intracellular contents and necrotic death.
Why is PNC-27 reported to affect transformed but not untransformed cells in culture?
The proposed basis is that HDM-2 is displayed on the outer plasma membrane of transformed cells and at low or undetectable levels on untransformed cells. Selectivity in these experiments tracks with membrane HDM-2 expression rather than with p53 status — PNC-27 has been reported to affect lines both with and without functional p53.
Has PNC-27 been tested in humans?
No. As of 2026 the published record consists of cell-culture, ex vivo, and rodent studies. No completed human clinical trial has been reported in the peer-reviewed literature.
What concentrations appear in the published in-vitro literature?
Reported IC50 values fall roughly in the 7-33 µM range depending on cell line — approximately 7-17 µM for the cervical lines in the 2025 report and approximately 33 µM for several breast and pancreatic lines. These are published experimental cell-culture parameters, not recommendations of any kind.
What is the purity level of Dynamite Research Peptides' PNC-27?
Our PNC-27 is typically 99%+ pure, verified by HPLC analysis. Batch analytical documentation is available on the product listing.
What research applications is PNC-27 suitable for?
In-vitro studies of p53-HDM-2 protein-protein interaction, membrane protein mislocalisation in transformed versus untransformed cell models, cell-penetrating peptide and membrane-permeabilisation mechanism work, and comparative necrosis-versus-apoptosis assay development.
All products are for research use only — not for human or animal consumption, and not for diagnostic or therapeutic use.